PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G35900.1
Common NameASL27, LBD35, MIK22.21
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 206aa    MW: 22816.2 Da    PI: 6.2258
Description LOB domain-containing protein 35
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G35900.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.61.1e-3461042100
       DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                  C+aCkv++ +Ca++C++ap+fp ++ ++f+ +h++FGa nv k+l++l++ +re+a+++l+yeAea  rdP+ G+vg+++++++ql++l+++++++k+
  AT5G35900.1   6 CSACKVMKCDCAPNCIFAPHFPLTNLETFERLHRIFGAGNVFKILANLDPIQRETAVNALCYEAEALERDPIFGCVGIFNHYKNQLQNLDEQINSAKN 103
                  **********************************************************************************************9998 PP

       DUF260 100 e 100
                  e
  AT5G35900.1 104 E 104
                  7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.9894105IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-316102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MNSTCCSACK VMKCDCAPNC IFAPHFPLTN LETFERLHRI FGAGNVFKIL ANLDPIQRET  60
AVNALCYEAE ALERDPIFGC VGIFNHYKNQ LQNLDEQINS AKNELAAIIG LDNVPQYSSI  120
PMPADFLTNK FSLHPYIEKM EGLDEVQKKE LMQLPPVDAQ VIVNEMFRKR GNIKICGGHG  180
DACASTSGGT SATQKTLPFP QNHNQP
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402563680.0
Genevisible249671_at0.0
Expression AtlasAT5G35900-
AtGenExpressAT5G35900-
ATTED-IIAT5G35900-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G35900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G35900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0052360.0AB005236.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MIK22.
GenBankAB4738600.0AB473860.1 Arabidopsis thaliana ASL27 mRNA for ASYMMETRIC LEAVES2-like 27 protein, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankDQ0566960.0DQ056696.1 Arabidopsis thaliana LOB domain family protein (At5g35900) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198439.11e-154LOB domain-containing protein 35
SwissprotQ9FFL31e-156LBD35_ARATH; LOB domain-containing protein 35
STRINGAT5G35900.11e-153(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45251455
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Ma S,Gong Q,Bohnert HJ
    Dissecting salt stress pathways.
    J. Exp. Bot., 2006. 57(5): p. 1097-107
    [PMID:16510518]
  4. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  5. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]